Lineage for d2rfgc_ (2rfg C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836349Species Hahella chejuensis [TaxId:158327] [188235] (1 PDB entry)
  8. 2836352Domain d2rfgc_: 2rfg C: [168083]
    Other proteins in same PDB: d2rfgb2
    automated match to d1dhpa_
    complexed with eoh, mg

Details for d2rfgc_

PDB Entry: 2rfg (more details), 1.5 Å

PDB Description: Crystal structure of dihydrodipicolinate synthase from Hahella chejuensis at 1.5A resolution
PDB Compounds: (C:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d2rfgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rfgc_ c.1.10.0 (C:) automated matches {Hahella chejuensis [TaxId: 158327]}
mfrgsliamitpfingqvdekalaglvdwqikhgahglvpvgttgesptlteeehkrvva
lvaeqaqgrvpviagagsnnpveavryaqhaqqagadavlcvagyynrpsqeglyqhfkm
vhdaidipiivynippravvdikpetmarlaalprivgvkdattdlarisrermlinkpf
sflsgddmtaiaynasggqgcisvsaniapalygqmqtatlqgdfrealrihdllaplhe
alfrepspagakyaasllglcneecrlpivplseqtksdikniinelyr

SCOPe Domain Coordinates for d2rfgc_:

Click to download the PDB-style file with coordinates for d2rfgc_.
(The format of our PDB-style files is described here.)

Timeline for d2rfgc_: