SCOPe 2.06: Domain d2rfga_: 2rfg A:

Lineage for d2rfga_ (2rfg A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (75 species)
   not a true protein

7. Species Hahella chejuensis [TaxId:158327] [188235] (1 PDB entry)

8. Domain d2rfga_: 2rfg A: [168081]
   Other proteins in same PDB: d2rfgb2
   automated match to d1dhpa_
   complexed with eoh, mg

Details for d2rfga_

PDB Entry: 2rfg, 1.5 Å

PDB Description: Crystal structure of dihydrodipicolinate synthase from Hahella chejuensis at 1.5A resolution

PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d2rfga_:

Sequence; same for both SEQRES and ATOM records:

>d2rfga_ c.1.10.0 (A:) automated matches {Hahella chejuensis [TaxId: 158327]}
mfrgsliamitpfingqvdekalaglvdwqikhgahglvpvgttgesptlteeehkrvva
lvaeqaqgrvpviagagsnnpveavryaqhaqqagadavlcvagyynrpsqeglyqhfkm
vhdaidipiivynippravvdikpetmarlaalprivgvkdattdlarisrermlinkpf
sflsgddmtaiaynasggqgcisvsaniapalygqmqtatlqgdfrealrihdllaplhe
alfrepspagakyaasllglcneecrlpivplseqtksdikniinelyr

Timeline for d2rfga_:

• d2rfga_ first appeared in SCOPe 2.01
  
• d2rfga_ appears in SCOPe 2.05
  
• d2rfga_ appears in SCOPe 2.07
  
• d2rfga_ appears in the current release, SCOPe 2.08