Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Clostridium perfringens [TaxId:1502] [188628] (5 PDB entries) |
Domain d2rf8b_: 2rf8 B: [168076] automated match to d3pvaa_ complexed with gol; mutant |
PDB Entry: 2rf8 (more details), 2.9 Å
SCOPe Domain Sequences for d2rf8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rf8b_ d.153.1.0 (B:) automated matches {Clostridium perfringens [TaxId: 1502]} matglaletkdglhlfgrnmdieysfnqsiifiprnfkcvnksnkkelttkyavlgmgti fddyptfadgmnekglgcaglnfpvyvsyskediegktnipvynfllwvlanfssveevk ealknanivdipisenipnttlhwmisditgksivveqtkeklnvfdnnigvltnsptfd whvanlnqyvglrynqvpefklgdqsltalgqgtglvglpgdftpasrfirvaflrdami kndkdsidlieffhilnnvamvrgstrtveeksdltqytscmclekgiyyyntyennqin aidmnkenldgneiktykynktlsinhvn
Timeline for d2rf8b_: