Lineage for d2rf7d_ (2rf7 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734319Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2734320Protein Cytochrome c nitrite reductase [48718] (5 species)
  7. 2734324Species Escherichia coli K-12 [TaxId:83333] [188395] (1 PDB entry)
  8. 2734328Domain d2rf7d_: 2rf7 D: [168074]
    automated match to d1gu6a_
    complexed with ca, edo, hec; mutant

Details for d2rf7d_

PDB Entry: 2rf7 (more details), 2.04 Å

PDB Description: crystal structure of the escherichia coli nrfa mutant q263e
PDB Compounds: (D:) Cytochrome c-552

SCOPe Domain Sequences for d2rf7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rf7d_ a.138.1.3 (D:) Cytochrome c nitrite reductase {Escherichia coli K-12 [TaxId: 83333]}
tveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghaf
avtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivn
nlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchvey
yfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaehpeyetwtagihg
knnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsi
ndlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhape
eglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekq
dfiktvipqweeqarknglls

SCOPe Domain Coordinates for d2rf7d_:

Click to download the PDB-style file with coordinates for d2rf7d_.
(The format of our PDB-style files is described here.)

Timeline for d2rf7d_: