Class a: All alpha proteins [46456] (289 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
Protein Cytochrome c nitrite reductase [48718] (5 species) |
Species Escherichia coli K-12 [TaxId:83333] [188395] (1 PDB entry) |
Domain d2rf7b_: 2rf7 B: [168072] automated match to d1gu6a_ complexed with ca, edo, hec; mutant |
PDB Entry: 2rf7 (more details), 2.04 Å
SCOPe Domain Sequences for d2rf7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rf7b_ a.138.1.3 (B:) Cytochrome c nitrite reductase {Escherichia coli K-12 [TaxId: 83333]} tveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghaf avtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivn nlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchvey yfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaehpeyetwtagihg knnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsi ndlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhape eglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekq dfiktvipqweeqarknglls
Timeline for d2rf7b_: