SCOPe 2.06: Domain d2reya1: 2rey A:263-355

Lineage for d2reya1 (2rey A:263-355)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [188234] (5 PDB entries)

8. Domain d2reya1: 2rey A:263-355 [168070]
   Other proteins in same PDB: d2reya2
   automated match to d1l6oa_

Details for d2reya1

PDB Entry: 2rey, 1.55 Å

PDB Description: crystal structure of the pdz domain of human dishevelled 2 (homologous to drosophila dsh)

PDB Compounds: (A:) Segment polarity protein dishevelled homolog DVL-2

SCOPe Domain Sequences for d2reya1:

Sequence, based on SEQRES records:

>d2reya1 b.36.1.1 (A:263-355) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]}
lniitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvnd
mnfenmsnddavrvlrdivhkpgpivltvakcw

Sequence, based on observed residues (ATOM records):

>d2reya1 b.36.1.1 (A:263-355) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]}
lniitvtlnmeynflgisivgqsggiyigsimkggavaadgriepgdmllqvndmnfenm
snddavrvlrdivhkpgpivltvakcw

Timeline for d2reya1:

• d2reya1 first appeared in SCOPe 2.01, called d2reya_
  
• d2reya1 was called d2reya_ in SCOPe 2.05
  
• d2reya1 appears in SCOPe 2.07
  
• d2reya1 appears in the current release, SCOPe 2.08