Lineage for d2reya1 (2rey A:263-355)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2048292Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2048293Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2048294Family b.36.1.1: PDZ domain [50157] (47 protein domains)
    Pfam PF00595
  6. 2048477Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (3 species)
  7. 2048486Species Human (Homo sapiens) [TaxId:9606] [188234] (5 PDB entries)
  8. 2048490Domain d2reya1: 2rey A:263-355 [168070]
    Other proteins in same PDB: d2reya2
    automated match to d1l6oa_

Details for d2reya1

PDB Entry: 2rey (more details), 1.55 Å

PDB Description: crystal structure of the pdz domain of human dishevelled 2 (homologous to drosophila dsh)
PDB Compounds: (A:) Segment polarity protein dishevelled homolog DVL-2

SCOPe Domain Sequences for d2reya1:

Sequence, based on SEQRES records: (download)

>d2reya1 b.36.1.1 (A:263-355) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]}
lniitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvnd
mnfenmsnddavrvlrdivhkpgpivltvakcw

Sequence, based on observed residues (ATOM records): (download)

>d2reya1 b.36.1.1 (A:263-355) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]}
lniitvtlnmeynflgisivgqsggiyigsimkggavaadgriepgdmllqvndmnfenm
snddavrvlrdivhkpgpivltvakcw

SCOPe Domain Coordinates for d2reya1:

Click to download the PDB-style file with coordinates for d2reya1.
(The format of our PDB-style files is described here.)

Timeline for d2reya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2reya2