Lineage for d2reia1 (2rei A:607-899)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (18 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (728 PDB entries)
  8. 2545238Domain d2reia1: 2rei A:607-899 [168067]
    Other proteins in same PDB: d2reia2
    automated match to d1jpaa_
    complexed with mpd

Details for d2reia1

PDB Entry: 2rei (more details), 1.6 Å

PDB Description: Kinase domain of human ephrin type-A receptor 7 (Epha7)
PDB Compounds: (A:) Ephrin type-A receptor 7

SCOPe Domain Sequences for d2reia1:

Sequence, based on SEQRES records: (download)

>d2reia1 d.144.1.7 (A:607-899) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tyidpetyedpnravhqfakeldascikiervigagefgevcsgrlklpgkrdvavaikt
lkvgytekqrrdflceasimgqfdhpnvvhlegvvtrgkpvmiviefmengaldaflrkh
dgqftviqlvgmlrgiaagmryladmgyvhrdlaarnilvnsnlvckvsdfglsrviedd
peavytttggkipvrwtapeaiqyrkftsasdvwsygivmwevmsygerpywdmsnqdvi
kaieegyrlpapmdcpaglhqlmldcwqkeraerpkfeqivgildkmirnpns

Sequence, based on observed residues (ATOM records): (download)

>d2reia1 d.144.1.7 (A:607-899) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tyidpetyedpnravhqfakeldascikiervigagefgevcsgrlklpgkrdvavaikt
lkvgytekqrrdflceasimgqfdhpnvvhlegvvtrgkpvmiviefmengaldaflrkh
dgqftviqlvgmlrgiaagmryladmgyvhrdlaarnilvnsnlvckvsdfglpvrwtap
eaiqyrkftsasdvwsygivmwevmsygerpywdmsnqdvikaieegyrlpapmdcpagl
hqlmldcwqkeraerpkfeqivgildkmirnpns

SCOPe Domain Coordinates for d2reia1:

Click to download the PDB-style file with coordinates for d2reia1.
(The format of our PDB-style files is described here.)

Timeline for d2reia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2reia2