Lineage for d2re9a_ (2re9 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777598Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2777599Protein automated matches [190873] (4 species)
    not a true protein
  7. 2777600Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)
  8. 2777635Domain d2re9a_: 2re9 A: [168062]
    automated match to d1a8ma_
    complexed with gol, mg

Details for d2re9a_

PDB Entry: 2re9 (more details), 2.1 Å

PDB Description: crystal structure of tl1a at 2.1 a
PDB Compounds: (A:) TNF superfamily ligand TL1A

SCOPe Domain Sequences for d2re9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2re9a_ b.22.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lradgdkprahltvvrqtptqhfknqfpalhwehelglaftknrmnytnkfllipesgdy
fiysqvtfrgmtsecseirqagrpnkpdsitvvitkvtdsypeptqllmgtksvcevgsn
wfqpiylgamfslqegdklmvnvsdislvdytkedktffgafll

SCOPe Domain Coordinates for d2re9a_:

Click to download the PDB-style file with coordinates for d2re9a_.
(The format of our PDB-style files is described here.)

Timeline for d2re9a_: