Lineage for d2rdlb_ (2rdl B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2406349Protein automated matches [190044] (14 species)
    not a true protein
  7. 2406394Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [188254] (1 PDB entry)
  8. 2406396Domain d2rdlb_: 2rdl B: [168061]
    automated match to d1pjpa_
    complexed with so4

Details for d2rdlb_

PDB Entry: 2rdl (more details), 2.5 Å

PDB Description: Hamster Chymase 2
PDB Compounds: (B:) Chymase 2

SCOPe Domain Sequences for d2rdlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdlb_ b.47.1.2 (B:) automated matches {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}
iiggtecrpharpymayleivtpenhlsacsgflirrnfvmtaahcagrsitvllgahnk
kvkedtwqklevekqfphpkyddrlvlndimllklkekanltlgvgtlpisaksnsippg
rvcravgwgrtnvneppsdtlqevkmrildpqackhfedfhqepqlcvgnpkkirnvykg
dsggpllcagiaqgiasyvlrnakppsvftrishyrpwinkilren

SCOPe Domain Coordinates for d2rdlb_:

Click to download the PDB-style file with coordinates for d2rdlb_.
(The format of our PDB-style files is described here.)

Timeline for d2rdlb_: