Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein automated matches [190044] (14 species) not a true protein |
Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [188254] (1 PDB entry) |
Domain d2rdlb_: 2rdl B: [168061] automated match to d1pjpa_ complexed with so4 |
PDB Entry: 2rdl (more details), 2.5 Å
SCOPe Domain Sequences for d2rdlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rdlb_ b.47.1.2 (B:) automated matches {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} iiggtecrpharpymayleivtpenhlsacsgflirrnfvmtaahcagrsitvllgahnk kvkedtwqklevekqfphpkyddrlvlndimllklkekanltlgvgtlpisaksnsippg rvcravgwgrtnvneppsdtlqevkmrildpqackhfedfhqepqlcvgnpkkirnvykg dsggpllcagiaqgiasyvlrnakppsvftrishyrpwinkilren
Timeline for d2rdlb_: