SCOPe 2.06: Domain d2rd7c_: 2rd7 C:

Lineage for d2rd7c_ (2rd7 C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein automated matches [190163] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188452] (13 PDB entries)

8. Domain d2rd7c_: 2rd7 C: [168056]
   automated match to d1iw2a_
   complexed with cl

Details for d2rd7c_

PDB Entry: 2rd7, 2.15 Å

PDB Description: human complement membrane attack proteins share a common fold with bacterial cytolysins

PDB Compounds: (C:) Complement component C8 gamma chain

SCOPe Domain Sequences for d2rd7c_:

Sequence, based on SEQRES records:

>d2rd7c_ b.60.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tiqpkanfdaqqfagtwllvavgsacrflqeqghraeattlhvapqgtamavstfrkldg
icwqvrqlygdtgvlgrfllqardargavhvvvaetdyqsfavlyleragqlsvklyars
lpvsdsvlsgfeqrvqeahltedqifyfpkygfceaadqfhvldev

Sequence, based on observed residues (ATOM records):

>d2rd7c_ b.60.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tiqpkanfdaqqfagtwllvavgsacrflqeraeattlhvapqgtmavstfrkldgicwq
vrqlydtgvlgrfllqrdargavhvvvaetdyqsfavlyleraglsvklyarslpvsdsv
lsgfeqrvqeahltedqifyfpkygfceaadqfhvldev

Timeline for d2rd7c_:

• d2rd7c_ first appeared in SCOPe 2.01
  
• d2rd7c_ appears in SCOPe 2.05
  
• d2rd7c_ appears in SCOPe 2.07
  
• d2rd7c_ appears in the current release, SCOPe 2.08