Lineage for d2rd7c_ (2rd7 C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2395398Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2395857Protein automated matches [190163] (13 species)
    not a true protein
  7. 2395883Species Human (Homo sapiens) [TaxId:9606] [188452] (13 PDB entries)
  8. 2395902Domain d2rd7c_: 2rd7 C: [168056]
    automated match to d1iw2a_
    complexed with cl

Details for d2rd7c_

PDB Entry: 2rd7 (more details), 2.15 Å

PDB Description: human complement membrane attack proteins share a common fold with bacterial cytolysins
PDB Compounds: (C:) Complement component C8 gamma chain

SCOPe Domain Sequences for d2rd7c_:

Sequence, based on SEQRES records: (download)

>d2rd7c_ b.60.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tiqpkanfdaqqfagtwllvavgsacrflqeqghraeattlhvapqgtamavstfrkldg
icwqvrqlygdtgvlgrfllqardargavhvvvaetdyqsfavlyleragqlsvklyars
lpvsdsvlsgfeqrvqeahltedqifyfpkygfceaadqfhvldev

Sequence, based on observed residues (ATOM records): (download)

>d2rd7c_ b.60.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tiqpkanfdaqqfagtwllvavgsacrflqeraeattlhvapqgtmavstfrkldgicwq
vrqlydtgvlgrfllqrdargavhvvvaetdyqsfavlyleraglsvklyarslpvsdsv
lsgfeqrvqeahltedqifyfpkygfceaadqfhvldev

SCOPe Domain Coordinates for d2rd7c_:

Click to download the PDB-style file with coordinates for d2rd7c_.
(The format of our PDB-style files is described here.)

Timeline for d2rd7c_: