Lineage for d2rd5d_ (2rd5 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950865Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2950866Protein automated matches [190753] (21 species)
    not a true protein
  7. 2951061Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187948] (3 PDB entries)
  8. 2951069Domain d2rd5d_: 2rd5 D: [168055]
    Other proteins in same PDB: d2rd5a_, d2rd5b_
    automated match to d1qy7a_
    complexed with adp, arg, atp, mg, nlg

Details for d2rd5d_

PDB Entry: 2rd5 (more details), 2.51 Å

PDB Description: structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana
PDB Compounds: (D:) pii protein

SCOPe Domain Sequences for d2rd5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rd5d_ d.58.5.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dyipdskfykveaivrpwriqqvssallkigirgvtvsdvrgfgaqggsterhggsefse
dkfvakvkmeivvkkdqvesvintiiegartgeigdgkifvlpvsdvirvrtgergekae
kmtgdm

SCOPe Domain Coordinates for d2rd5d_:

Click to download the PDB-style file with coordinates for d2rd5d_.
(The format of our PDB-style files is described here.)

Timeline for d2rd5d_: