Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (4 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187948] (3 PDB entries) |
Domain d2rd5c_: 2rd5 C: [168054] automated match to d1qy7a_ complexed with adp, arg, atp, mg, nlg |
PDB Entry: 2rd5 (more details), 2.51 Å
SCOPe Domain Sequences for d2rd5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rd5c_ d.58.5.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} dyipdskfykveaivrpwriqqvssallkigirgvtvsdvrgfgaqggsterhggsefse dkfvakvkmeivvkkdqvesvintiiegartgeigdgkifvlpvsdvirvrtgergekae kmtgd
Timeline for d2rd5c_: