Lineage for d2rd4b_ (2rd4 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346077Protein Snake phospholipase A2 [48624] (38 species)
  7. 2346088Species Andaman cobra (Naja sagittifera), isoform 3 [TaxId:195058] [89170] (4 PDB entries)
    heterodimer of two different isoforms
  8. 2346092Domain d2rd4b_: 2rd4 B: [168053]
    automated match to d1s6bb_
    complexed with ca

Details for d2rd4b_

PDB Entry: 2rd4 (more details), 2.97 Å

PDB Description: design of specific inhibitors of phospholipase a2: crystal structure of the complex of phospholipase a2 with pentapeptide leu-val-phe-phe- ala at 2.9 a resolution
PDB Compounds: (B:) Phospholipase A2 isoform 2

SCOPe Domain Sequences for d2rd4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rd4b_ a.133.1.2 (B:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), isoform 3 [TaxId: 195058]}
nrwqfknmisctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
nprfrtysyectagtltctgrnnacaasvcdcdrlaaicfagapyndnnynidlqarcn

SCOPe Domain Coordinates for d2rd4b_:

Click to download the PDB-style file with coordinates for d2rd4b_.
(The format of our PDB-style files is described here.)

Timeline for d2rd4b_: