Lineage for d2rd4a_ (2rd4 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733045Species Andaman cobra (Naja sagittifera), isoform 2 [TaxId:195058] [89169] (4 PDB entries)
    heterodimer of two different isoforms
  8. 2733049Domain d2rd4a_: 2rd4 A: [168052]
    automated match to d1s6ba_
    complexed with ca

Details for d2rd4a_

PDB Entry: 2rd4 (more details), 2.97 Å

PDB Description: design of specific inhibitors of phospholipase a2: crystal structure of the complex of phospholipase a2 with pentapeptide leu-val-phe-phe- ala at 2.9 a resolution
PDB Compounds: (A:) Phospholipase A2 isoform 1

SCOPe Domain Sequences for d2rd4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rd4a_ a.133.1.2 (A:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), isoform 2 [TaxId: 195058]}
ntyqfknmiqctvpkrswwdfadygcycgrggsgtpiddldrccqvhdncynsareqggc
rpkqktysyeckagtlscsgsnnscaatvcdcdrlaaicfagapyndnnynidlkarcq

SCOPe Domain Coordinates for d2rd4a_:

Click to download the PDB-style file with coordinates for d2rd4a_.
(The format of our PDB-style files is described here.)

Timeline for d2rd4a_: