Lineage for d2rd3d1 (2rd3 D:1-217)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732860Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. 2732861Protein automated matches [190172] (9 species)
    not a true protein
  7. 2732862Species Helicobacter pylori [TaxId:210] [189118] (2 PDB entries)
  8. 2732866Domain d2rd3d1: 2rd3 D:1-217 [168051]
    Other proteins in same PDB: d2rd3a2, d2rd3d2
    automated match to d1to9b_

Details for d2rd3d1

PDB Entry: 2rd3 (more details), 2.7 Å

PDB Description: crystal structure of tena homologue (hp1287) from helicobacter pylori
PDB Compounds: (D:) Transcriptional regulator

SCOPe Domain Sequences for d2rd3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rd3d1 a.132.1.0 (D:1-217) automated matches {Helicobacter pylori [TaxId: 210]}
mqvsqylyqnaqsiwgdcishpfvqgigrgtlerdkfrfyiiqdylflleyakvfalgvv
kacdeavmrefsnaiqdilnnemsihnhyirelqitqkelqnacptlanksytsymlaeg
fkgsikevaaavlscgwsylviaqnlsqipnalehafyghwikgysskefqacvnwninl
ldsltlasskqeieklkeifittseyeylfwdmayqs

SCOPe Domain Coordinates for d2rd3d1:

Click to download the PDB-style file with coordinates for d2rd3d1.
(The format of our PDB-style files is described here.)

Timeline for d2rd3d1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rd3d2