SCOPe 2.01: Domain d2rcta_: 2rct A:

Lineage for d2rcta_ (2rct A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187133] (3 PDB entries)

8. Domain d2rcta_: 2rct A: [168049]
   automated match to d1b4ma_
   complexed with rtl, so4, tla

Details for d2rcta_

PDB Entry: 2rct, 1.2 Å

PDB Description: Crystal structure of human holo cellular retinol-binding protein II (CRBP-II)

PDB Compounds: (A:) Retinol-binding protein II, cellular

SCOPe Domain Sequences for d2rcta_:

Sequence; same for both SEQRES and ATOM records:

>d2rcta_ b.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrgstrdqngtwemesnenfegymkaldidfatrkiavrltqtkvidqdgdnfktkttst
frnydvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkqwiegdkly
leltcgdqvcrqvfkkklvpr

Timeline for d2rcta_:

• d2rcta_ is new in SCOPe 2.01-stable
  
• d2rcta_ appears in SCOPe 2.02
  
• d2rcta_ appears in the current release, SCOPe 2.08, called d2rcta1