SCOPe 2.08: Domain d2rbma_: 2rbm A:

Lineage for d2rbma_ (2rbm A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family)

5. Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
   barrel, closed; n=5, S=10

6. Protein Staphylococcal nuclease [50201] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50202] (268 PDB entries)
   Uniprot P00644 89-223

8. Domain d2rbma_: 2rbm A: [168047]
   automated match to d1joka_
   complexed with ca, po4, thp

Details for d2rbma_

PDB Entry: 2rbm, 1.9 Å

PDB Description: crystal structure of staphylococcal nuclease variant delta+phs i72k at cryogenic temperature

PDB Compounds: (A:) Thermonuclease

SCOPe Domain Sequences for d2rbma_:

Sequence; same for both SEQRES and ATOM records:

>d2rbma_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
klhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakk
kevefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaq
akkeklniws

Timeline for d2rbma_:

• d2rbma_ first appeared in SCOPe 2.01
  
• d2rbma_ appears in SCOPe 2.07