Lineage for d2rbma_ (2rbm A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2787873Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 2787874Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 2787875Protein Staphylococcal nuclease [50201] (1 species)
  7. 2787876Species Staphylococcus aureus [TaxId:1280] [50202] (268 PDB entries)
    Uniprot P00644 89-223
  8. 2787946Domain d2rbma_: 2rbm A: [168047]
    automated match to d1joka_
    complexed with ca, po4, thp

Details for d2rbma_

PDB Entry: 2rbm (more details), 1.9 Å

PDB Description: crystal structure of staphylococcal nuclease variant delta+phs i72k at cryogenic temperature
PDB Compounds: (A:) Thermonuclease

SCOPe Domain Sequences for d2rbma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rbma_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
klhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakk
kevefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaq
akkeklniws

SCOPe Domain Coordinates for d2rbma_:

Click to download the PDB-style file with coordinates for d2rbma_.
(The format of our PDB-style files is described here.)

Timeline for d2rbma_: