SCOPe 2.01: Domain d2rblm_: 2rbl M:

Lineage for d2rblm_ (2rbl M:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (9 PDB entries)

8. Domain d2rblm_: 2rbl M: [168046]
   automated match to d1tena_

Details for d2rblm_

PDB Entry: 2rbl, 2.1 Å

PDB Description: high resolution design of a protein loop

PDB Compounds: (M:) Tenascin

SCOPe Domain Sequences for d2rblm_:

Sequence, based on SEQRES records:

>d2rblm_ b.1.2.1 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldapsqievkdvtdttalitwsmqlsqlegieltygikdvpgdrttidltedenqysign
lkpdteyevslisrrgdmssnpaketftt

Sequence, based on observed residues (ATOM records):

>d2rblm_ b.1.2.1 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldapsqievkdvtalitwsegieltygikdvpgdrttidltedenqysignlkpdteyev
slisrrgdmssnpaketftt

Timeline for d2rblm_:

• d2rblm_ is new in SCOPe 2.01-stable
  
• d2rblm_ appears in SCOPe 2.02
  
• d2rblm_ appears in the current release, SCOPe 2.08