| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein automated matches [190888] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries) |
| Domain d2rb8a_: 2rb8 A: [168043] automated match to d1tena_ |
PDB Entry: 2rb8 (more details), 1.45 Å
SCOPe Domain Sequences for d2rb8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rb8a_ b.1.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrldapsqievkdvtdttalitwmppsqpvdgfeltygikdvpgdrttidltedenqysi
gnlkpdteyevslisrrgdmssnpaketfttgl
Timeline for d2rb8a_: