Lineage for d2rb8a_ (2rb8 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2358952Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2358953Family b.1.2.1: Fibronectin type III [49266] (45 protein domains)
    Pfam PF00041
  6. 2359419Protein automated matches [190888] (1 species)
    not a true protein
  7. 2359420Species Human (Homo sapiens) [TaxId:9606] [188282] (31 PDB entries)
  8. 2359421Domain d2rb8a_: 2rb8 A: [168043]
    automated match to d1tena_

Details for d2rb8a_

PDB Entry: 2rb8 (more details), 1.45 Å

PDB Description: High resolution design of a protein loop
PDB Compounds: (A:) Tenascin

SCOPe Domain Sequences for d2rb8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rb8a_ b.1.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrldapsqievkdvtdttalitwmppsqpvdgfeltygikdvpgdrttidltedenqysi
gnlkpdteyevslisrrgdmssnpaketfttgl

SCOPe Domain Coordinates for d2rb8a_:

Click to download the PDB-style file with coordinates for d2rb8a_.
(The format of our PDB-style files is described here.)

Timeline for d2rb8a_: