Lineage for d2rb4a_ (2rb4 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870647Protein ATP-dependent RNA helicase DDX25 [142310] (1 species)
  7. 2870648Species Human (Homo sapiens) [TaxId:9606] [142311] (1 PDB entry)
    Uniprot Q9UHL0 307-474
  8. 2870649Domain d2rb4a_: 2rb4 A: [168041]
    automated match to d2g2ja1
    complexed with cl, so4, zn

Details for d2rb4a_

PDB Entry: 2rb4 (more details), 2.8 Å

PDB Description: crystal structure of the helicase domain of human ddx25 rna helicase
PDB Compounds: (A:) ATP-dependent RNA helicase DDX25

SCOPe Domain Sequences for d2rb4a_:

Sequence, based on SEQRES records: (download)

>d2rb4a_ c.37.1.19 (A:) ATP-dependent RNA helicase DDX25 {Human (Homo sapiens) [TaxId: 9606]}
ltlnnirqyyvlcehrkdkyqalcniygsitigqaiifcqtrrnakwltvemiqdghqvs
llsgeltveqrasiiqrfrdgkekvlittnvcargidvkqvtivvnfdlpvkqgeepdye
tylhrigrtgrfgkkglafnmievdelpslmkiqdhfnssikqlnaedmd

Sequence, based on observed residues (ATOM records): (download)

>d2rb4a_ c.37.1.19 (A:) ATP-dependent RNA helicase DDX25 {Human (Homo sapiens) [TaxId: 9606]}
ltlnnirqyyvlcehrkdkyqalcniygsitigqaiifcqtrrnakwltvemiqdghqvs
llsgeltveqrasiiqrfrdgkekvlittnvcargidvkqvtivvnfdlpvgeepdyety
lhrigrtkkglafnmievdelpslmkiqdhfnssikqlnaedmd

SCOPe Domain Coordinates for d2rb4a_:

Click to download the PDB-style file with coordinates for d2rb4a_.
(The format of our PDB-style files is described here.)

Timeline for d2rb4a_: