![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.64: Saposin-like [47861] (2 superfamilies) 5 helices; folded leaf, closed |
![]() | Superfamily a.64.1: Saposin [47862] (5 families) ![]() Lipid-binding can promote conformational changes and oligomerisation in some members |
![]() | Family a.64.1.1: NKL-like [47863] (4 proteins) |
![]() | Protein Saposin C [89077] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89078] (11 PDB entries) |
![]() | Domain d2rb3b1: 2rb3 B:3-80 [168038] Other proteins in same PDB: d2rb3a2, d2rb3b2, d2rb3c2, d2rb3d2 automated match to d2gtga1 complexed with gol, so4 |
PDB Entry: 2rb3 (more details), 2.1 Å
SCOPe Domain Sequences for d2rb3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rb3b1 a.64.1.1 (B:3-80) Saposin C {Human (Homo sapiens) [TaxId: 9606]} gfcevckklvgyldrnleknstkqeilaalekgcsflpdpyqkqcdqfvaeyepvlieil vevmdpsfvclkigacps
Timeline for d2rb3b1: