Lineage for d2rara_ (2rar A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1010738Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1010739Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1010982Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 1011046Protein Sugar-phosphate phosphatase BT4131 [142157] (1 species)
  7. 1011047Species Bacteroides thetaiotaomicron [TaxId:818] [142158] (5 PDB entries)
    Uniprot Q8A090 2-261
  8. 1011051Domain d2rara_: 2rar A: [168035]
    automated match to d1ymqa1
    complexed with mg, vn4

Details for d2rara_

PDB Entry: 2rar (more details), 1.52 Å

PDB Description: x-ray crystallographic structures show conservation of a trigonal- bipyramidal intermediate in a phosphoryl-transfer superfamily.
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d2rara_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rara_ c.108.1.10 (A:) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]}
mtkalffdiagtlvsfethripsstiealeaahakglkifiatgrpkaiinnlselqdrn
lidgyitmngaycfvgeeviyksaipqeevkamaafcekkgvpcifveehnisvcqpnem
vkkifydflhvnviptvsfeeasnkeviqmtpfiteeeekevlpsiptceigrwypafad
vtakgdtkqkgideiirhfgikleetmsfgdggndismlrhaaigvamgqakedvkaaad
yvtapidedgiskamkhfgii

SCOPe Domain Coordinates for d2rara_:

Click to download the PDB-style file with coordinates for d2rara_.
(The format of our PDB-style files is described here.)

Timeline for d2rara_: