![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins) contains an alpha+beta subdomain inserted into a new site after strand 3 |
![]() | Protein Sugar-phosphate phosphatase BT4131 [142157] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [142158] (5 PDB entries) Uniprot Q8A090 2-261 |
![]() | Domain d2rara_: 2rar A: [168035] automated match to d1ymqa1 complexed with mg, vn4 |
PDB Entry: 2rar (more details), 1.52 Å
SCOPe Domain Sequences for d2rara_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rara_ c.108.1.10 (A:) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} mtkalffdiagtlvsfethripsstiealeaahakglkifiatgrpkaiinnlselqdrn lidgyitmngaycfvgeeviyksaipqeevkamaafcekkgvpcifveehnisvcqpnem vkkifydflhvnviptvsfeeasnkeviqmtpfiteeeekevlpsiptceigrwypafad vtakgdtkqkgideiirhfgikleetmsfgdggndismlrhaaigvamgqakedvkaaad yvtapidedgiskamkhfgii
Timeline for d2rara_: