Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (40 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [188592] (1 PDB entry) |
Domain d2raod_: 2rao D: [168034] automated match to d1aj9b_ complexed with hem, oxy |
PDB Entry: 2rao (more details), 2 Å
SCOPe Domain Sequences for d2raod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2raod_ a.1.1.2 (D:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} vhlsseeksavtalwgkvnveevggealgrllvvypwtqrffesfgdlssanavmnnpkv kahgkkvlaafseglshldnlkgtfaklselhcdklhvdpenfrllgnvlvivlshhfgk eftpqvqaayqkvvagvanalahkyh
Timeline for d2raod_: