SCOPe 2.05: Domain d2raod_: 2rao D:

Lineage for d2raod_ (2rao D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (40 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [188592] (1 PDB entry)

8. Domain d2raod_: 2rao D: [168034]
   automated match to d1aj9b_
   complexed with hem, oxy

Details for d2raod_

PDB Entry: 2rao, 2 Å

PDB Description: x ray crystal structure of rabbit hemoglobin (oxy form) at 2.0 angstrom resolution

PDB Compounds: (D:) Hemoglobin subunit beta-1/2

SCOPe Domain Sequences for d2raod_:

Sequence; same for both SEQRES and ATOM records:

>d2raod_ a.1.1.2 (D:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
vhlsseeksavtalwgkvnveevggealgrllvvypwtqrffesfgdlssanavmnnpkv
kahgkkvlaafseglshldnlkgtfaklselhcdklhvdpenfrllgnvlvivlshhfgk
eftpqvqaayqkvvagvanalahkyh

Timeline for d2raod_:

• d2raod_ first appeared in SCOPe 2.01
  
• d2raod_ appears in SCOPe 2.04
  
• d2raod_ appears in SCOPe 2.06
  
• d2raod_ appears in the current release, SCOPe 2.08