Lineage for d2raoc_ (2rao C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301593Protein automated matches [190359] (42 species)
    not a true protein
  7. 2301883Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [188592] (1 PDB entry)
  8. 2301886Domain d2raoc_: 2rao C: [168033]
    automated match to d1aj9a_
    complexed with hem, oxy

Details for d2raoc_

PDB Entry: 2rao (more details), 2 Å

PDB Description: x ray crystal structure of rabbit hemoglobin (oxy form) at 2.0 angstrom resolution
PDB Compounds: (C:) Hemoglobin subunit alpha-1/2

SCOPe Domain Sequences for d2raoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2raoc_ a.1.1.2 (C:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
vlspadktniktawekigshggeygaeavermflgfpttktyfphfdfthgseqikahgk
kvsealtkavghlddlpgalstlsdlhahklrvdpvnfkllshcllvtlanhhpseftpa
vhasldkflanvstvltskyr

SCOPe Domain Coordinates for d2raoc_:

Click to download the PDB-style file with coordinates for d2raoc_.
(The format of our PDB-style files is described here.)

Timeline for d2raoc_: