Lineage for d2r2fb_ (2r2f B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536008Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 536009Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 536385Family a.25.1.2: Ribonucleotide reductase-like [47253] (7 proteins)
  6. 536487Protein Ribonucleotide reductase R2 [47257] (8 species)
  7. 536570Species Salmonella typhimurium [TaxId:90371] [47259] (2 PDB entries)
  8. 536574Domain d2r2fb_: 2r2f B: [16803]
    complexed with fe, o

Details for d2r2fb_

PDB Entry: 2r2f (more details), 2.25 Å

PDB Description: ribonucleotide reductase r2f protein from salmonella typhimurium (oxidized)

SCOP Domain Sequences for d2r2fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r2fb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Salmonella typhimurium}
klsrisainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvft
gltlldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevdaa
yawseenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltnt
adlirliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneirytealy
aetgwvndvkaflcynankalmnlgyealfppemadvnpailaal

SCOP Domain Coordinates for d2r2fb_:

Click to download the PDB-style file with coordinates for d2r2fb_.
(The format of our PDB-style files is described here.)

Timeline for d2r2fb_: