SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2r9ea_ (2r9e A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004800Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2004801Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2004802Family a.103.1.1: Citrate synthase [48257] (2 protein domains)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2004868Protein automated matches [190675] (7 species)
    not a true protein
  7. 2004886Species Thermoplasma acidophilum [TaxId:2303] [188213] (3 PDB entries)
  8. 2004891Domain d2r9ea_: 2r9e A: [168025]
    automated match to d1o7xc_
    complexed with sdx

Details for d2r9ea_

PDB Entry: 2r9e (more details), 1.95 Å

PDB Description: The structure of the binary complex of citryl dethia COA and citrate synthase from the thermophilic archaeonthermoplasma acidophilum
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d2r9ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r9ea_ a.103.1.1 (A:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
teeiskgledvnikwtrlttidgnkgilryggysvediiasgaqdeeiqylflygnlpte
qelrkyketvqkgykipdfvinairqlpresdavamqmaavaamaasetkfkwnkdtdrd
vaaemigrmsaitvnvyrhimnmpaelpkpsdsyaesflnaafgrkatkeeidamntali
lytdhevpasttaglvavstlsdmysgitaalaalkgplhggaaeaaiaqfdeikdpamv
ekwfndniingkkrlmgfghrvyktydprakifkgiaeklsskkpevhkvyeiatkledf
gikafgskgiypntdyfsgivymsigfplrnniytalfalsrvtgwqahfieyveeqqrl
irpravyvgpaerkyvpiaer

SCOPe Domain Coordinates for d2r9ea_:

Click to download the PDB-style file with coordinates for d2r9ea_.
(The format of our PDB-style files is described here.)

Timeline for d2r9ea_: