Lineage for d2r97c_ (2r97 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102350Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2102768Family c.23.5.8: WrbA-like [117474] (3 protein domains)
  6. 2102777Protein Trp repressor binding protein WrbA [117475] (4 species)
  7. 2102795Species Escherichia coli [TaxId:562] [188617] (3 PDB entries)
  8. 2102799Domain d2r97c_: 2r97 C: [168024]
    automated match to d1zwka1
    complexed with fmn

Details for d2r97c_

PDB Entry: 2r97 (more details), 2 Å

PDB Description: crystal structure of e. coli wrba in complex with fmn
PDB Compounds: (C:) Flavoprotein WrbA

SCOPe Domain Sequences for d2r97c_:

Sequence, based on SEQRES records: (download)

>d2r97c_ c.23.5.8 (C:) Trp repressor binding protein WrbA {Escherichia coli [TaxId: 562]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi
aryqgeyvaglavklng

Sequence, based on observed residues (ATOM records): (download)

>d2r97c_ c.23.5.8 (C:) Trp repressor binding protein WrbA {Escherichia coli [TaxId: 562]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelrggtpygattiaggdgsrqpsqeelsiaryqge
yvaglavklng

SCOPe Domain Coordinates for d2r97c_:

Click to download the PDB-style file with coordinates for d2r97c_.
(The format of our PDB-style files is described here.)

Timeline for d2r97c_: