SCOPe 2.06: Domain d2r97a_: 2r97 A:

Lineage for d2r97a_ (2r97 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.8: WrbA-like [117474] (3 proteins)

6. Protein Trp repressor binding protein WrbA [117475] (4 species)

7. Species Escherichia coli [TaxId:562] [188617] (3 PDB entries)

8. Domain d2r97a_: 2r97 A: [168023]
   automated match to d1zwka1
   complexed with fmn

Details for d2r97a_

PDB Entry: 2r97, 2 Å

PDB Description: crystal structure of e. coli wrba in complex with fmn

PDB Compounds: (A:) Flavoprotein WrbA

SCOPe Domain Sequences for d2r97a_:

Sequence; same for both SEQRES and ATOM records:

>d2r97a_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Escherichia coli [TaxId: 562]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi
aryqgeyvaglavklng

Timeline for d2r97a_:

• d2r97a_ first appeared in SCOPe 2.01
  
• d2r97a_ appears in SCOPe 2.05
  
• d2r97a_ appears in SCOPe 2.07
  
• d2r97a_ appears in the current release, SCOPe 2.08