Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2r97a_ (2r97 A:)

  1. Root: SCOP 1.75B
  2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. Family c.23.5.8: WrbA-like [117474] (3 protein domains)
  6. Protein Trp repressor binding protein WrbA [117475] (3 species)
  7. Species Escherichia coli [TaxId:562] [188617] (3 PDB entries)
  8. Domain d2r97a_: 2r97 A: [168023]
    automated match to d1zwka1
    complexed with fmn

Details for d2r97a_

PDB Entry: 2r97 (more details)
PDB Description: crystal structure of e. coli wrba in complex with fmn
PDB Compounds: (A:) Flavoprotein WrbA

SCOP Domain Sequences for d2r97a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r97a_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Escherichia coli [TaxId: 562]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi
aryqgeyvaglavklng

SCOP Domain Coordinates for d2r97a_:

Click to download the PDB-style file with coordinates for d2r97a_.
(The format of our PDB-style files is described here.)

Timeline for d2r97a_:

d2r97a_ appears in SCOP 1.75A


d2r97a_
(click for larger image)


d2r97a_ in context of chain



d2r97a_ in context of PDB
Domains from other chains:
d2r97c_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu