| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.8: WrbA-like [117474] (3 proteins) |
| Protein Trp repressor binding protein WrbA [117475] (4 species) |
| Species Escherichia coli [TaxId:562] [188617] (3 PDB entries) |
| Domain d2r96c_: 2r96 C: [168022] automated match to d1zwka1 complexed with edo, fmn |
PDB Entry: 2r96 (more details), 2.6 Å
SCOPe Domain Sequences for d2r96c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r96c_ c.23.5.8 (C:) Trp repressor binding protein WrbA {Escherichia coli [TaxId: 562]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi
aryqgeyvaglavklng
Timeline for d2r96c_: