Lineage for d2r96c_ (2r96 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856848Family c.23.5.8: WrbA-like [117474] (3 proteins)
  6. 2856857Protein Trp repressor binding protein WrbA [117475] (4 species)
  7. 2856875Species Escherichia coli [TaxId:562] [188617] (3 PDB entries)
  8. 2856881Domain d2r96c_: 2r96 C: [168022]
    automated match to d1zwka1
    complexed with edo, fmn

Details for d2r96c_

PDB Entry: 2r96 (more details), 2.6 Å

PDB Description: crystal structure of e. coli wrba in complex with fmn
PDB Compounds: (C:) Flavoprotein WrbA

SCOPe Domain Sequences for d2r96c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r96c_ c.23.5.8 (C:) Trp repressor binding protein WrbA {Escherichia coli [TaxId: 562]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi
aryqgeyvaglavklng

SCOPe Domain Coordinates for d2r96c_:

Click to download the PDB-style file with coordinates for d2r96c_.
(The format of our PDB-style files is described here.)

Timeline for d2r96c_: