| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.8: WrbA-like [117474] (3 protein domains) |
| Protein Trp repressor binding protein WrbA [117475] (3 species) |
| Species Escherichia coli [TaxId:562] [188617] (3 PDB entries) |
| Domain d2r96c_: 2r96 C: [168022] automated match to d1zwka1 complexed with edo, fmn |
| PDB Entry: 2r96 (more details) PDB Description: crystal structure of e. coli wrba in complex with fmn
PDB Compounds: (C:) Flavoprotein WrbASCOP Domain Sequences for d2r96c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r96c_ c.23.5.8 (C:) Trp repressor binding protein WrbA {Escherichia coli [TaxId: 562]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi
aryqgeyvaglavklng
SCOP Domain Coordinates for d2r96c_:
Click to download the PDB-style file with coordinates for d2r96c_. (The format of our PDB-style files is described here.)
Timeline for d2r96c_:
d2r96c_ appears in SCOP 1.75A | d2r96c_ (click for larger image) d2r96c_ in context of chain d2r96c_ in context of PDB Domains from other chains: d2r96a_ |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |