Lineage for d2r2fa_ (2r2f A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46712Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 46713Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 46831Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 46907Protein Ribonucleotide reductase R2 [47257] (4 species)
  7. 46934Species Salmonella typhimurium [TaxId:90371] [47259] (2 PDB entries)
  8. 46937Domain d2r2fa_: 2r2f A: [16802]

Details for d2r2fa_

PDB Entry: 2r2f (more details), 2.25 Å

PDB Description: ribonucleotide reductase r2f protein from salmonella typhimurium (oxidized)

SCOP Domain Sequences for d2r2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r2fa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Salmonella typhimurium}
srisainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvftgl
tlldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevdaaya
wseenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltntad
lirliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneirytealyae
tgwvndvkaflcynankalmnlgyealfppemadvnpailaalspn

SCOP Domain Coordinates for d2r2fa_:

Click to download the PDB-style file with coordinates for d2r2fa_.
(The format of our PDB-style files is described here.)

Timeline for d2r2fa_: