Lineage for d2r94b_ (2r94 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836703Species Thermoproteus tenax [TaxId:2271] [188383] (2 PDB entries)
  8. 2836709Domain d2r94b_: 2r94 B: [168018]
    automated match to d1w37a_
    complexed with pyr

Details for d2r94b_

PDB Entry: 2r94 (more details), 2.2 Å

PDB Description: crystal structure of kd(p)ga from t.tenax
PDB Compounds: (B:) 2-Keto-3-deoxy-(6-phospho-)gluconate aldolase

SCOPe Domain Sequences for d2r94b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r94b_ c.1.10.0 (B:) automated matches {Thermoproteus tenax [TaxId: 2271]}
meivapvittfrggrldpelfanhvknitskgvdvvfvagttglgpalslqekmeltdaa
tsaarrvivqvaslnadeaialakyaesrgaeavaslppyyfprlserqiakyfrdlcsa
vsipvflynypaavgrdvdaraakelgcirgvkdtneslahtlaykrylpqarvyngsds
lvfasfavrldgvvassanylpellagirdavaagdierarslqflldeivesarhigya
aavyelveifqgyeageprgpvypldpeekawlraavakaksql

SCOPe Domain Coordinates for d2r94b_:

Click to download the PDB-style file with coordinates for d2r94b_.
(The format of our PDB-style files is described here.)

Timeline for d2r94b_: