Lineage for d1r2fb_ (1r2f B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2448Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 2449Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 2557Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 2613Protein Ribonucleotide reductase R2 [47257] (3 species)
  7. 2633Species Salmonella typhimurium [TaxId:90371] [47259] (2 PDB entries)
  8. 2635Domain d1r2fb_: 1r2f B: [16801]

Details for d1r2fb_

PDB Entry: 1r2f (more details), 2.1 Å

PDB Description: ribonucleotide reductase r2f protein from salmonella typhimurium

SCOP Domain Sequences for d1r2fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2fb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Salmonella typhimurium}
isainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvftgltl
ldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevdaayaws
eenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltntadli
rliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneirytealyaetg
wvndvkaflcynankalmnlgyealfppemadvnpailaal

SCOP Domain Coordinates for d1r2fb_:

Click to download the PDB-style file with coordinates for d1r2fb_.
(The format of our PDB-style files is described here.)

Timeline for d1r2fb_: