![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
![]() | Protein Ribonucleotide reductase R2 [47257] (10 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [47259] (3 PDB entries) |
![]() | Domain d1r2fb_: 1r2f B: [16801] complexed with fe |
PDB Entry: 1r2f (more details), 2.1 Å
SCOPe Domain Sequences for d1r2fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r2fb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Salmonella typhimurium [TaxId: 90371]} isainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvftgltl ldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevdaayaws eenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltntadli rliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneirytealyaetg wvndvkaflcynankalmnlgyealfppemadvnpailaal
Timeline for d1r2fb_: