SCOPe 2.05: Domain d2r80d_: 2r80 D:

Lineage for d2r80d_ (2r80 D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (40 species)
   not a true protein

7. Species Domestic pigeon (Columba livia) [TaxId:8932] [188616] (2 PDB entries)

8. Domain d2r80d_: 2r80 D: [168005]
   automated match to d1fawb_
   complexed with hem, oxy

Details for d2r80d_

PDB Entry: 2r80, 1.44 Å

PDB Description: pigeon hemoglobin (oxy form)

PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d2r80d_:

Sequence; same for both SEQRES and ATOM records:

>d2r80d_ a.1.1.2 (D:) automated matches {Domestic pigeon (Columba livia) [TaxId: 8932]}
vhwsaeekqlitsiwgkvnvadcgaealarllivypwtqrffssfgnlssataisgnpnv
kahgkkvltsfgdavknldnikgtfaqlselhcdklhvdpenfrllgdilviilaahfgk
dftpecqaawqklvrvvahalarkyh

Timeline for d2r80d_:

• d2r80d_ first appeared in SCOPe 2.01
  
• d2r80d_ appears in SCOPe 2.04
  
• d2r80d_ appears in SCOPe 2.06
  
• d2r80d_ appears in the current release, SCOPe 2.08