![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein automated matches [190359] (43 species) not a true protein |
![]() | Species Domestic pigeon (Columba livia) [TaxId:8932] [188616] (2 PDB entries) |
![]() | Domain d2r80d_: 2r80 D: [168005] automated match to d1fawb_ complexed with hem, oxy |
PDB Entry: 2r80 (more details), 1.44 Å
SCOPe Domain Sequences for d2r80d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r80d_ a.1.1.2 (D:) automated matches {Domestic pigeon (Columba livia) [TaxId: 8932]} vhwsaeekqlitsiwgkvnvadcgaealarllivypwtqrffssfgnlssataisgnpnv kahgkkvltsfgdavknldnikgtfaqlselhcdklhvdpenfrllgdilviilaahfgk dftpecqaawqklvrvvahalarkyh
Timeline for d2r80d_: