| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein automated matches [190359] (43 species) not a true protein |
| Species Domestic pigeon (Columba livia) [TaxId:8932] [188616] (2 PDB entries) |
| Domain d2r80a_: 2r80 A: [168002] automated match to d1fawa_ complexed with hem, oxy |
PDB Entry: 2r80 (more details), 1.44 Å
SCOPe Domain Sequences for d2r80a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r80a_ a.1.1.2 (A:) automated matches {Domestic pigeon (Columba livia) [TaxId: 8932]}
vlsandksnvkavfakiggqagdlggealerlfitypqtktyfphfdlshgsaqikghgk
kvaealveaanhiddiagalsklsdlhaqklrvdpvnfkllghcflvvvavhfpslltpe
vhasldkfvlavgtvltakyr
Timeline for d2r80a_: