Lineage for d2r6tb_ (2r6t B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1266228Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 1266247Family a.25.2.0: automated matches [191442] (1 protein)
    not a true family
  6. 1266248Protein automated matches [190652] (6 species)
    not a true protein
  7. 1266267Species Lactobacillus reuteri [TaxId:1598] [188444] (8 PDB entries)
  8. 1266277Domain d2r6tb_: 2r6t B: [167999]
    automated match to d1rtyb_
    complexed with atp, mg

Details for d2r6tb_

PDB Entry: 2r6t (more details), 2.61 Å

PDB Description: structure of a r132k variant pduo-type atp:co(i)rrinoid adenosyltransferase from lactobacillus reuteri complexed with atp
PDB Compounds: (B:) Cobalamin adenosyltransferase PduO-like protein

SCOPe Domain Sequences for d2r6tb_:

Sequence, based on SEQRES records: (download)

>d2r6tb_ a.25.2.0 (B:) automated matches {Lactobacillus reuteri [TaxId: 1598]}
iytkngdkgqtriigkqilykndprvaaygevdelnswvgytkslinshtqvlsneleei
qqllfdcghdlatpadderhsfkfkqeqptvwleekidnytqvvpavkkfilpggtqlas
alhvartitkraerqivqlmreeqinqdvlifinrlsdyffaaaryanyleqqpdmlyr

Sequence, based on observed residues (ATOM records): (download)

>d2r6tb_ a.25.2.0 (B:) automated matches {Lactobacillus reuteri [TaxId: 1598]}
iytkngdkgqtriigkilykndprvaaygevdelnswvgytkslinshtqvlsneleeiq
qllfdcghdlatpadhsfkfkqeqptvwleekidnytqvvpavkkfilpggtqlasalhv
artitkraerqivqlmreeqinqdvlifinrlsdyffaaaryanyleqqpdmlyr

SCOPe Domain Coordinates for d2r6tb_:

Click to download the PDB-style file with coordinates for d2r6tb_.
(The format of our PDB-style files is described here.)

Timeline for d2r6tb_: