Lineage for d2r6sa_ (2r6s A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2070873Family b.82.2.3: Gab protein (hypothetical protein YgaT) [63855] (2 protein domains)
    automatically mapped to Pfam PF08943
  6. 2070878Protein automated matches [190931] (1 species)
    not a true protein
  7. 2070879Species Escherichia coli [TaxId:562] [188460] (1 PDB entry)
  8. 2070880Domain d2r6sa_: 2r6s A: [167997]
    automated match to d1jr7a_
    complexed with bcn, fe2, gol, so4

Details for d2r6sa_

PDB Entry: 2r6s (more details), 2.1 Å

PDB Description: Crystal structure of Gab protein
PDB Compounds: (A:) Gab protein

SCOPe Domain Sequences for d2r6sa_:

Sequence, based on SEQRES records: (download)

>d2r6sa_ b.82.2.3 (A:) automated matches {Escherichia coli [TaxId: 562]}
gqdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvgkilddl
canqlqplllktllnraegallinavgiddvaqademvklatavahligrsnfdamsgqy
yarfvvknvdnsdsylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhld
dwehldhyfrhplarrpmrfaappsknvskdvfhpvfdvdqqgrpvmryidqfvqpkdfe
egvwlselsdaietskgilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyf
ayathhyqthq

Sequence, based on observed residues (ATOM records): (download)

>d2r6sa_ b.82.2.3 (A:) automated matches {Escherichia coli [TaxId: 562]}
gqdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvgkilddl
canqlqplllktllnraegallinavgiddvaqademvklatavahligrsnfdamsgqy
yarfvvknylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhlddwehld
hyfrhplarrpmrfaapkdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwlselsdai
etskgilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfayathhyqthq

SCOPe Domain Coordinates for d2r6sa_:

Click to download the PDB-style file with coordinates for d2r6sa_.
(The format of our PDB-style files is described here.)

Timeline for d2r6sa_: