Lineage for d2r50d_ (2r50 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301593Protein automated matches [190359] (42 species)
    not a true protein
  7. 2301832Species Maize (Zea mays) [TaxId:76912] [188014] (1 PDB entry)
  8. 2301836Domain d2r50d_: 2r50 D: [167988]
    automated match to d1d8ua_
    complexed with acy, hem, so4

Details for d2r50d_

PDB Entry: 2r50 (more details), 2.2 Å

PDB Description: The crystal structure of nonsymbiotic corn hemoglobin 1
PDB Compounds: (D:) non-symbiotic hemoglobin

SCOPe Domain Sequences for d2r50d_:

Sequence, based on SEQRES records: (download)

>d2r50d_ a.1.1.2 (D:) automated matches {Maize (Zea mays) [TaxId: 76912]}
vfgeeqealvlkswavmkkdaanlglrfflkvfeiapsakqmfsflrdsdvpleknpklk
thamsvfvmtceaaaqlrkagkvtvrettlkrlgathlrygvadghfevtgfalletike
alpadmwslemkkawaeaysqlvaaikremkpda

Sequence, based on observed residues (ATOM records): (download)

>d2r50d_ a.1.1.2 (D:) automated matches {Maize (Zea mays) [TaxId: 76912]}
vfgeeqealvlkswavmkkdaanlglrfflkvfeiapsakqmfseknpklkthamsvfvm
tceaaaqlrkagkvtvrettlkrlgathlrygvadghfevtgfalletikealpadmwsl
emkkawaeaysqlvaaikremkpda

SCOPe Domain Coordinates for d2r50d_:

Click to download the PDB-style file with coordinates for d2r50d_.
(The format of our PDB-style files is described here.)

Timeline for d2r50d_: