Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (40 species) not a true protein |
Species Maize (Zea mays) [TaxId:76912] [188014] (1 PDB entry) |
Domain d2r50c_: 2r50 C: [167987] automated match to d1d8ua_ complexed with acy, hem, so4 |
PDB Entry: 2r50 (more details), 2.2 Å
SCOPe Domain Sequences for d2r50c_:
Sequence, based on SEQRES records: (download)
>d2r50c_ a.1.1.2 (C:) automated matches {Maize (Zea mays) [TaxId: 76912]} vfgeeqealvlkswavmkkdaanlglrfflkvfeiapsakqmfsflrdsdvpleknpklk thamsvfvmtceaaaqlrkagkvtvrettlkrlgathlrygvadghfevtgfalletike alpadmwslemkkawaeaysqlvaaikremkpda
>d2r50c_ a.1.1.2 (C:) automated matches {Maize (Zea mays) [TaxId: 76912]} vfgeeqealvlkswavmkkdaanlglrfflkvfeiapsakqmfsfleknpklkthamsvf vmtceaaaqlrkagkvtvrettlkrlgathlrygvadghfevtgfalletikealpadmw slemkkawaeaysqlvaaikremkpda
Timeline for d2r50c_: