SCOPe 2.04: Domain d2r50c_: 2r50 C:

Lineage for d2r50c_ (2r50 C:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (38 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:76912] [188014] (1 PDB entry)

8. Domain d2r50c_: 2r50 C: [167987]
   automated match to d1d8ua_
   complexed with acy, hem, so4

Details for d2r50c_

PDB Entry: 2r50, 2.2 Å

PDB Description: The crystal structure of nonsymbiotic corn hemoglobin 1

PDB Compounds: (C:) non-symbiotic hemoglobin

SCOPe Domain Sequences for d2r50c_:

Sequence, based on SEQRES records:

>d2r50c_ a.1.1.2 (C:) automated matches {Maize (Zea mays) [TaxId: 76912]}
vfgeeqealvlkswavmkkdaanlglrfflkvfeiapsakqmfsflrdsdvpleknpklk
thamsvfvmtceaaaqlrkagkvtvrettlkrlgathlrygvadghfevtgfalletike
alpadmwslemkkawaeaysqlvaaikremkpda

Sequence, based on observed residues (ATOM records):

>d2r50c_ a.1.1.2 (C:) automated matches {Maize (Zea mays) [TaxId: 76912]}
vfgeeqealvlkswavmkkdaanlglrfflkvfeiapsakqmfsfleknpklkthamsvf
vmtceaaaqlrkagkvtvrettlkrlgathlrygvadghfevtgfalletikealpadmw
slemkkawaeaysqlvaaikremkpda

Timeline for d2r50c_:

• d2r50c_ first appeared in SCOPe 2.01
  
• d2r50c_ appears in SCOPe 2.03
  
• d2r50c_ appears in SCOPe 2.05
  
• d2r50c_ appears in the current release, SCOPe 2.08