Lineage for d2r50c_ (2r50 C:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903555Protein automated matches [190359] (30 species)
    not a true protein
  7. 903714Species Maize (Zea mays) [TaxId:76912] [188014] (1 PDB entry)
  8. 903717Domain d2r50c_: 2r50 C: [167987]
    automated match to d1d8ua_
    complexed with acy, hem, so4

Details for d2r50c_

PDB Entry: 2r50 (more details), 2.2 Å

PDB Description: The crystal structure of nonsymbiotic corn hemoglobin 1
PDB Compounds: (C:) non-symbiotic hemoglobin

SCOPe Domain Sequences for d2r50c_:

Sequence, based on SEQRES records: (download)

>d2r50c_ a.1.1.2 (C:) automated matches {Maize (Zea mays) [TaxId: 76912]}
vfgeeqealvlkswavmkkdaanlglrfflkvfeiapsakqmfsflrdsdvpleknpklk
thamsvfvmtceaaaqlrkagkvtvrettlkrlgathlrygvadghfevtgfalletike
alpadmwslemkkawaeaysqlvaaikremkpda

Sequence, based on observed residues (ATOM records): (download)

>d2r50c_ a.1.1.2 (C:) automated matches {Maize (Zea mays) [TaxId: 76912]}
vfgeeqealvlkswavmkkdaanlglrfflkvfeiapsakqmfsfleknpklkthamsvf
vmtceaaaqlrkagkvtvrettlkrlgathlrygvadghfevtgfalletikealpadmw
slemkkawaeaysqlvaaikremkpda

SCOPe Domain Coordinates for d2r50c_:

Click to download the PDB-style file with coordinates for d2r50c_.
(The format of our PDB-style files is described here.)

Timeline for d2r50c_: