Lineage for d2r50a_ (2r50 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688727Species Maize (Zea mays) [TaxId:76912] [188014] (1 PDB entry)
  8. 2688728Domain d2r50a_: 2r50 A: [167985]
    automated match to d1d8ua_
    complexed with acy, hem, so4

Details for d2r50a_

PDB Entry: 2r50 (more details), 2.2 Å

PDB Description: The crystal structure of nonsymbiotic corn hemoglobin 1
PDB Compounds: (A:) non-symbiotic hemoglobin

SCOPe Domain Sequences for d2r50a_:

Sequence, based on SEQRES records: (download)

>d2r50a_ a.1.1.2 (A:) automated matches {Maize (Zea mays) [TaxId: 76912]}
vvfgeeqealvlkswavmkkdaanlglrfflkvfeiapsakqmfsflrdsdvpleknpkl
kthamsvfvmtceaaaqlrkagkvtvrettlkrlgathlrygvadghfevtgfalletik
ealpadmwslemkkawaeaysqlvaaikremkpda

Sequence, based on observed residues (ATOM records): (download)

>d2r50a_ a.1.1.2 (A:) automated matches {Maize (Zea mays) [TaxId: 76912]}
vvfgeeqealvlkswavmkkdaanlglrfflkvfeiapsakqmfleknpklkthamsvfv
mtceaaaqlrkagkvtvrettlkrlgathlrygvadghfevtgfalletikealpadmws
lemkkawaeaysqlvaaikremkpda

SCOPe Domain Coordinates for d2r50a_:

Click to download the PDB-style file with coordinates for d2r50a_.
(The format of our PDB-style files is described here.)

Timeline for d2r50a_: