![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein automated matches [190359] (43 species) not a true protein |
![]() | Species Maize (Zea mays) [TaxId:76912] [188014] (1 PDB entry) |
![]() | Domain d2r50a_: 2r50 A: [167985] automated match to d1d8ua_ complexed with acy, hem, so4 |
PDB Entry: 2r50 (more details), 2.2 Å
SCOPe Domain Sequences for d2r50a_:
Sequence, based on SEQRES records: (download)
>d2r50a_ a.1.1.2 (A:) automated matches {Maize (Zea mays) [TaxId: 76912]} vvfgeeqealvlkswavmkkdaanlglrfflkvfeiapsakqmfsflrdsdvpleknpkl kthamsvfvmtceaaaqlrkagkvtvrettlkrlgathlrygvadghfevtgfalletik ealpadmwslemkkawaeaysqlvaaikremkpda
>d2r50a_ a.1.1.2 (A:) automated matches {Maize (Zea mays) [TaxId: 76912]} vvfgeeqealvlkswavmkkdaanlglrfflkvfeiapsakqmfleknpklkthamsvfv mtceaaaqlrkagkvtvrettlkrlgathlrygvadghfevtgfalletikealpadmws lemkkawaeaysqlvaaikremkpda
Timeline for d2r50a_: