SCOPe 2.05: Domain d1rnra_: 1rnr A:

Lineage for d1rnra_ (1rnr A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (9 species)

7. Species Escherichia coli [TaxId:562] [47258] (24 PDB entries)

8. Domain d1rnra_: 1rnr A: [16798]
   complexed with fe, hg

Details for d1rnra_

PDB Entry: 1rnr, 2.5 Å

PDB Description: autocatalytic generation of dopa in the engineered protein r2 f208y from escherichia coli ribonucleotide reductase and crystal structure of the dopa-208 protein

PDB Compounds: (A:) ribonucleotide reductase r1 protein

SCOPe Domain Sequences for d1rnra_:

Sequence; same for both SEQRES and ATOM records:

>d1rnra_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsatkndqlkepmffgqpvqvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv

Timeline for d1rnra_:

• d1rnra_ first appeared (with stable ids) in SCOP 1.55
  
• d1rnra_ appears in SCOPe 2.04
  
• d1rnra_ appears in SCOPe 2.06
  
• d1rnra_ appears in the current release, SCOPe 2.08